HPA006753

Anti-PITRM1 antibody produced in rabbit

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Metalloprotease 1 antibody produced in rabbit, Anti-Pitrilysin metalloproteinase 1 antibody produced in rabbit, Anti-Presequence protease, mitochondrial precursor antibody produced in rabbit, Anti-hMP1 antibody produced in rabbit, Anti-hPreP antibody produced in rabbit
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA006753
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: independent; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• sequência de imunogênio: ELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEI
• nº de adesão UniProt: Q5JRX3
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PITRM1(10531)

Descrição

Descrição geral

PITRM1 (Pitrilysin metallopeptidase 1) is a metalloendoprotease belonging to the pitrilysin family. It comprises of a conserved catalytic domain at the N-terminal region. It is highly expressed in the muscle, heart and lesser extent in the brain, pancreas, liver, lung, and placenta.

Imunogênio

Presequence protease, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

PITRM1 (Pitrilysin metallopeptidase 1) acts as a mitochondrial amyloid-β peptide (Aβ)-degrading enzyme localized in the mitochondrial matrix. Its activity is controlled by Zn⁺²-dependent metalloprotease inhibitor. The temporal lobe of the human brain has a high tendency of Aβ accumulation and reactive oxygen species (ROS) production. In Alzheimer′s disease, the low proteolytic activity of PITRM1 in the brain mitochondria has been reported. Studies have been suggested that high ROS production results in decreased PITRM1 activity followed by Aβ accumulation. As a result, it leads to mitochondrial toxicity and neuronal death. Thus, it proves the impact of PITRM1 in the Alzheimer′s disease.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70795

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)