Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV53752

Sigma-Aldrich

Anti-AGBL5 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-ATP/GTP binding protein-like 5, Anti-FLJ21839

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

47 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... AGBL5(60509)

Imunogênio

Synthetic peptide directed towards the C terminal region of human AGBL5

Aplicação

Anti-AGBL5 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

AGBL5 (ATP/GTP binding protein-like 5) gene encodes a 886 amino acid containing protein that belongs to peptidase M14 family and is predominantly expressed in brain. AGBL5 possesses glutamylase activity and is involved in the metabolism of the polyglutamate side-chains of tubulin. It facilitates the removal of α and γ linked glutamates from tubulin.

Sequência

Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Iryna Berezniuk et al.
The Journal of biological chemistry, 288(42), 30445-30453 (2013-09-12)
Cytosolic carboxypeptidase 5 (CCP5) is a member of a subfamily of enzymes that cleave C-terminal and/or side chain amino acids from tubulin. CCP5 was proposed to selectively cleave the branch point of glutamylated tubulin, based on studies involving overexpression of
Ashish Lal et al.
PLoS genetics, 7(11), e1002363-e1002363 (2011-11-22)
A simple biochemical method to isolate mRNAs pulled down with a transfected, biotinylated microRNA was used to identify direct target genes of miR-34a, a tumor suppressor gene. The method reidentified most of the known miR-34a regulated genes expressed in K562

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica