Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV53693

Sigma-Aldrich

Anti-HSPA4L antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-APG-1, Anti-Heat shock 70 kDa protein 4-like, Anti-Osp94

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

95 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... HSPA4L(22824)

Descrição geral

Heat shock 70kDa protein 4L is a protein encoded by the HSPA4L gene in humans. Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones.

Imunogênio

Synthetic peptide directed towards the C terminal region of human HSPA4L

Aplicação

Anti-HSPA4L antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/mL.

Ações bioquímicas/fisiológicas

Hspa4l is expressed ubiquitously and predominantly in the testis and is highly expressed in spermatogenic cells. It plays an important role in osmotolerance. HSPA4L and HSPA4 collaborate in embryonic lung maturation and helps in air breathing during child birth. Osp94 also acts as molecular chaperone and possesses cytoprotective role from excessive stimulation from heat, hyper-ionic and osmotic stress which cause marked perturbation of intracellular protein function including the suppression of protein synthesis.

Sequência

Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Belal A Mohamed et al.
American journal of respiratory cell and molecular biology, 50(4), 817-824 (2013-08-29)
Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones. We generated Hspa4l(-/-)Hspa4(-/-) mice to investigate a functional complementarity between HSPA4L and HSPA4 during embryonic development. Hspa4l(-/-)Hspa4(-/-) embryos exhibited marked pulmonary hypoplasia
H Yamamoto et al.
Neuroscience, 158(4), 1691-1698 (2008-12-09)
Osmotic stress protein 94 (OSP94), a member of the heat shock protein 110/SSE subfamily, is expressed in certain organs such as the kidney, testis, and brain where it can act as a molecular chaperon. In general, its alteration in expression
Torsten Held et al.
Molecular and cellular biology, 26(21), 8099-8108 (2006-08-23)
The Hspa4l gene, also known as Apg1 or Osp94, belongs to the HSP110 heat shock gene family, which includes three genes encoding highly conserved proteins. This study shows that Hspa4l is expressed ubiquitously and predominantly in the testis. The protein

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica