AV53597
Anti-INHA antibody produced in rabbit
affinity isolated antibody
Sinônimo(s):
Anti-Inhibin, α
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous solution
peso molecular
40 kDa
reatividade de espécies
bovine, goat, sheep, human, pig
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... INHA(3623)
Descrição geral
NHA (inhibin, alpha) gene encodes the alpha subunit of inhibins A and B protein complexes that belongs to TGF-beta family. It is localized in the syncytiotrophoblast and the intermediate trophoblast of the placenta and may play a role in the mechanism of labor. INHA is also known as Inhibin α. Activin and inhibin are two closely related protein complexes involved in follicle-stimulating hormone (FSH) synthesis. They are produced in the gonads, pituitary gland, placenta, corpus luteum and other organs.
Imunogênio
Synthetic peptide directed towards the N terminal region of human INHA
Aplicação
Anti-INHA antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Ações bioquímicas/fisiológicas
Inhibins facilitates the regulation of numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Loss of expression of inhibinα results in high grade prostate cancer. Follicle-stimulating hormone (FSH) stimulates the secretion of inhibin from the granulosa cells of the ovarian follicles in the ovaries. In turn, inhibin suppresses FSH. Inhibin secretion is diminished by GHRH, and enhanced by insulin-like growth factor-1. Inhibin may involve competing with activin for binding to activin receptors and binding to inhibin-specific receptors. Activin, inhibin and follistatin participate as intraovarian regulatory molecules involved in follicular cell proliferation, differentiation, steroidogenesis, oocyte maturation and corpus luteum function.
Sequência
Synthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
G M Lambert-Messerlian et al.
Molecular and cellular endocrinology, 225(1-2), 101-108 (2004-09-29)
To date, the only routine clinical application of inhibin or activin measurement in testing for fetal abnormalities has been the use of inhibin A in prenatal screening for trisomy 21 (Down syndrome). Second trimester maternal serum levels of inhibin A
Stefano Luisi et al.
Human reproduction update, 11(2), 123-135 (2004-12-25)
A great deal of new information has arisen in the recent years concerning inhibin physiology and clinical relevance in reproductive medicine. It is now recognized that the two inhibin isoforms, named inhibin A and inhibin B, are produced by the
P van Zonneveld et al.
Human reproduction (Oxford, England), 18(3), 495-501 (2003-03-05)
The cause of declining fertility with age, in women who still have regular menstrual cycles, is not clear. Follicle development, endometrial growth and hormonal patterns were evaluated in cycles of older women (aged 41-46 years; n = 26) who previously
Matías L Stangaferro et al.
Animal reproduction science, 148(3-4), 97-108 (2014-07-09)
Cystic ovarian disease (COD) is an important cause of infertility in dairy cattle. Although many researchers have focused their work on the endocrine changes related to this disease, evidence indicates that intraovarian components play an important role in follicular persistence.
A Kondi-Pafiti et al.
Clinical and experimental obstetrics & gynecology, 40(1), 109-112 (2013-06-04)
The aim of the study was to examine, by an immunohistochemical method, the distribution of Inhibin-A and -B, in placentas from normal and pathological gestations. Sixty-two specimens of placental tissue were examined: i) ten cases from early gestations, ii) 28
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica