Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV48273

Sigma-Aldrich

Anti-ALDOC antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-ALDC, Anti-Aldolase C, fructose-bisphosphate

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

39 kDa

reatividade de espécies

dog, rat, human, bovine, horse, guinea pig, rabbit, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ALDOC(230)

Categorias relacionadas

Descrição geral

ALDOC codes for a class I fructose-biphosphate aldolase that catalyzes the breakdown of fructose-1,6-biphosphate to dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate during glycolysis. It also catalyzes the aldol cleavage of fructose-1 phosphate to DHAP and glyceraldehyde. ALDOC is expressed in the cerebellum, retina and other parts of the CNS. It is known to be upregulated in the brain and skeletal muscles cells of chickens during hypoxia.
Rabbit Anti-ALDOC antibody recognizes bovine, human, mouse, rat, zebrafish, and rabbit ALDOC.

Imunogênio

Synthetic peptide directed towards the N terminal region of human ALDOC

Aplicação

Rabbit Anti-ALDOC antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

Ações bioquímicas/fisiológicas

ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Sequência

Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

C F Wang et al.
Animal genetics, 38(3), 203-210 (2007-06-02)
Two sequence variants of the aldolase C (ALDOC) gene were discovered based on comparison of the sequences from an altiplano chicken breed (Tibetan chicken) and two lowland breeds (White Leghorn and ShouGuang). Gel-shift results indicated that one of these variants
Hirofumi Fujita et al.
PloS one, 9(1), e86679-e86679 (2014-01-30)
Aldolase C (Aldoc, also known as "zebrin II"), a brain type isozyme of a glycolysis enzyme, is expressed heterogeneously in subpopulations of cerebellar Purkinje cells (PCs) that are arranged longitudinally in a complex striped pattern in the cerebellar cortex, a

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica