AV46706

Anti-ST3GAL3 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-SIAT6, Anti-ST3 β-galactoside α-2,3-sialyltransferase 3, Anti-ST3GALII, Anti-ST3GalIII, Anti-ST3N
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 42 kDa
• reatividade de espécies: mouse, guinea pig, rabbit, horse, rat, bovine, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_777623
• nº de adesão UniProt: Q11203
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ST3GAL3(6487)

Descrição

Descrição geral

ST3 β-galactoside α-2,3-sialyltransferase 3 (ST3GAL3,ST3GalIII, SIAT6) is a sialic acid transferring type II membrane protein found primarily in the Gogi apparatus; wherein sialic acid is transferred from CMP-sialic acid to galactose residues. ST3GAL3 forms the sialyl Lewis epitope on proteins. Defects in ST3GAL3 are associated with cognitive dysfunction.

Especificidade

Anti-ST3GAL3 (AB1) polyclonal antibody reacts with chicken, pig, bovine, canine, human, mouse, and rat β-galactoside α-2,3-sialyltransferase 3 proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human ST3GAL3

Aplicação

Anti-ST3GAL3 (AB1) polyclonal antibody is used to tag β-galactoside α-2,3-sialyltransferase 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of β-galactoside α-2,3-sialyltransferase 3 in sialylation of glycoproteins in the Golgi apparatus.

Ações bioquímicas/fisiológicas

ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.

Sequência

Synthetic peptide located within the following region: MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable