AV46165

Anti-STIP1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-HOP, Anti-IEF-SSP-3521, Anti-P60, Anti-STI1, Anti-STI1L, Anti-Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 63 kDa
• reatividade de espécies: bovine, rat, horse, mouse, rabbit, human, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_006810
• nº de adesão UniProt: P31948
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... STIP1(10963)

Descrição

Descrição geral

Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) (STIP1, HOP, IEF-SSP-3521, STI1, STI1L, P60) is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 links the chaperones Hsp70 and Hsp90 together to facilitate their function. HOP ensures the productive folding of substrate proteins by controlling the chaperone activities of HSP70 and HSP90.

Especificidade

Anti-STIP1 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, and canine stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) proteins..

Imunogênio

Synthetic peptide directed towards the C terminal region of human STIP1

Aplicação

Anti-STIP1 (AB2) polyclonal antibody is used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) in the management of protein refolding by heat shock proteins such as Hsp70 and Hsp90.

Ações bioquímicas/fisiológicas

STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

Sequência

Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable