AV44398

Anti-ZDHHC13 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-FLJ10852, Anti-FLJ10941, Anti-HIP14L, Anti-HIP3RP, Anti-MGC64994, Anti-Zinc finger, DHHC-type containing 13
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 54 kDa
• reatividade de espécies: mouse, guinea pig, rat, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_061901
• nº de adesão UniProt: Q8IUH4-3
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... ZDHHC13(54503)

Descrição

Descrição geral

Zinc finger, DHHC-type containing 13 (ZDHHC13, HIP14L, HIP3RP) is a Huntingtin-interacting protein that mediates the dual functions of palmitoyl acyltransferase and Mg²⁺ transport qualifying it as a chanzyme. Protein palmitoylation is important for the regulation of important cellular processes such as protein trafficking, stability, and protein-protein interactions. Improper palmitoylation may underlie diseases such as human alopecia, osteoporosis, and amyloidosis and many other neurodegenerative diseases caused by protein misfolding and amyloidosis.

Especificidade

Anti-ZDHHC13 polyclonal antibody reacts with chicken, human, mouse, rat, zebrafish, and bovine zinc finger, DHHC-type containing 13 proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human ZDHHC13

Aplicação

Anti-ZDHHC13 polyclonal antibody is used to tag zinc finger, DHHC-type containing 13 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of zinc finger, DHHC-type containing 13 in processes that involve Mg²⁺ transport and protein palmitoylation.

Ações bioquímicas/fisiológicas

ZDHHC13 may be involved in the NF-kappa-B signaling pathway.

Sequência

Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable