Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV44161

Sigma-Aldrich

Anti-SLC6A18 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-FLJ31236, Anti-Solute carrier family 6, member 18, Anti-Xtrp2

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

69 kDa

reatividade de espécies

rat, human, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_872438

nº de adesão UniProt

Q96N87

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SLC6A18(348932)

Imunogênio

Synthetic peptide directed towards the middle region of human SLC6A18

Aplicação

Anti-SLC6A18 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Ações bioquímicas/fisiológicas

SLC6A18 (XT2) belongs to SLC6 family of transporters that mediate the movement of neurotransmitters, osmolytes and amino acids. XT2 is a neutral amino acid transporter present at the luminal membrane of kidney proximal tubules. The expression of SLC6A18 is associated with increased risk of myocardial infarction in a Japanese population.

Sequência

Synthetic peptide located within the following region: MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Ken Matsumoto et al.
Clinical biochemistry, 44(10-11), 789-794 (2011-03-23)
SLC6A18 (solute carrier family 6, member 18) acts as a specific transporter for neurotransmitters, amino acids and osmolytes such as betaine, taurine and creatine. The aim of the present study was to investigate the relationship between the human SLC6A18 gene
Dustin Singer et al.
The Journal of biological chemistry, 284(30), 19953-19960 (2009-05-30)
The orphan transporter Slc6a18 (XT2) is highly expressed at the luminal membrane of kidney proximal tubules and displays approximately 50% identity with Slc6a19 (B(0)AT1), which is the main neutral amino acid transporter in both kidney and small intestine. As yet

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica