AV39473
Anti-LZTS1 antibody produced in rabbit
IgG fraction of antiserum
Sinônimo(s):
Anti-Leucine zipper, putative tumor suppressor 1
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous solution
peso molecular
67 kDa
reatividade de espécies
horse, rat, guinea pig, mouse, bovine, human
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
Informações sobre genes
human ... LZTS1(11178)
Descrição geral
Leucine zipper, putative tumor suppressor 1 (LZTS1) is a protein that regulates the molecular events involved in progression of cells through the M phase of mitosis. It functions as a tumor suppressor for a range of major cancer histotypes, such as bladder cancer and urothelial carcinomas. LZTS1 is transiently expressed at the border of the ventricular and mantle zones in subsets of sensory and motor spinal neurons.
Especificidade
Anti-LZTS1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine leucine zipper, putative tumor suppressor 1 proteins.
Imunogênio
Synthetic peptide directed towards the C terminal region of human LZTS1
Aplicação
Anti-LZTS1 polyclonal antibody is used to tag leucine zipper, putative tumor suppressor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine zipper, putative tumor suppressor 1 as a tumor suppressor gene and mediator of M-phase cell cycle progression.
Ações bioquímicas/fisiológicas
Leucine zipper putative tumor suppressor 1 (LZTS1) is a tumor suppressor gene involved in the cell growth activity. It is down-regulated in several human malignancies. It retards the growth in cancer cells by regulating the mitotic process. It restricts Cdk1 (Cyclin-Dependent Kinase 1) activity by steadying the Cdc25C (cell division cycle 25C) phosphatase, a mitotic activator of Cdk1. Deregulation of this gene is associated with breast cancer and may serve as a prognostic factor for breast cancer therapy. It is found to be down-regulated by promoter methylation. This gene is found to be involved in ovarian carcinogenesis.
Sequência
Synthetic peptide located within the following region: QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Francesca Lovat et al.
Oncotarget, 5(4), 970-977 (2014-01-23)
The Leucine Zipper Tumor Suppressor 1 (LZTS1) is a tumor suppressor gene, located at chromosome 8p22, which is frequently altered in human cancer. In normal tissue, its ubiquitous expression regulates cell mitosis by the stabilization of microtubule networks. LZTS1-deficient mouse
H Ishii et al.
Proceedings of the National Academy of Sciences of the United States of America, 96(7), 3928-3933 (1999-03-31)
Alterations of human chromosome 8p occur frequently in many tumors. We identified a 1.5-Mb common region of allelic loss on 8p22 by allelotype analysis. cDNA selection allowed isolation of several genes, including FEZ1. The predicted Fez1 protein contained a leucine-zipper
Xin-Xin Wang et al.
Human pathology, 42(10), 1410-1419 (2011-03-23)
Leucine zipper putative tumor suppressor 1 is down-regulated by promoter methylation, but not frequently, in human malignancies, including breast cancer. Recent studies suggest that leucine zipper putative tumor suppressor 1 is a candidate for the metastasis modifier locus on human
Andrea Vecchione et al.
Cancer cell, 11(3), 275-289 (2007-03-14)
The FEZ1/LZTS1 (LZTS1) protein is frequently downregulated in human cancers of different histotypes. LZTS1 is expressed in normal tissues, and its introduction in cancer cells inhibits cell growth and suppresses tumorigenicity, owing to an accumulation of cells in G2/M. Here
Daniela Califano et al.
Journal of cellular physiology, 222(2), 382-386 (2009-11-04)
The FEZ1/LZTS1 (FEZ1) gene maps to chromosome 8p22 and is frequently altered in human cancer. FEZ1 has been proposed as a candidate tumour suppressor gene and its loss may contribute to tumour progression. We have analysed the expression of FEZ1
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica