AV34760

Anti-PHF17 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-FLJ22479, Anti-JADE1, Anti-KIAA1807, Anti-PHD finger protein 17
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 58 kDa
• reatividade de espécies: bovine, rat, guinea pig, horse, human, mouse, rabbit, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_079176
• nº de adesão UniProt: Q6IE81-3
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PHF17(79960)

Descrição

Descrição geral

PHF17 (PHD finger protein 17) is a short-lived, kidney-enriched Jade protein consisting of canonical plant homeodomain (PHD) finger protein and a non-canonical extended PHD with zinc-binding ability. It is localized in the nucleus and is highly expressed in kidney and renal proximal tubule cells. Rabbit Anti-PHF17 antibody recognizes human, mouse, rat, bovine, and chicken PHF17.

Imunogênio

Synthetic peptide directed towards the C terminal region of human PHF17

Aplicação

Rabbit Anti-PHF17 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Rabbit Anti-PHF17 antibody is suitable for western blot applications.

Ações bioquímicas/fisiológicas

PHF17 (PHD finger protein 17) is associated with several cellular activities such as chromatin remodeling, renal tubular epithelial cell differentiation, growth suppression, apoptosis and protein-protein interactions. It possesses transcriptional and endogenous histone acetyltransferase (HAT) activity. It acts as a transcriptional co-activator in the TIP60 mediated histone H4/H2A specific HAT activity. It has been reported that PHF17 may play a role in the renal cancer and von Hippel-Lindau disease. PHF17 also possesses tumour suppressor property. In the renal tumorigenesis, it controls canonical Wnt signaling pathway by ubiquitylating oncoprotein β-catenin in Wnt-responsive manner.

Sequência

Synthetic peptide located within the following region: EPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable