Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV34529

Sigma-Aldrich

Anti-SMARCAD1 (AB2) antibody produced in rabbit

affinity isolated antibody

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

39 kDa

reatividade de espécies

horse, human, dog

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

Descrição geral

SMARCAD1 is a SWI/SNF-related helicase that regulates heterochromatin organization and histone deacteylation. Studies in humans have reported that SMARCAD1 can enhance DNA end resection. SMARCAD1 mutation has been linked to autosomal-dominant adermatoglyphia.
Rabbit Anti-SMARCAD1 recognizes bovine, human, mouse, rat, and canine SMARCAD1.

Imunogênio

Synthetic peptide directed towards the N terminal region of human SMARCAD1

Aplicação

Rabbit Anti-SMARCAD1 is suitable for western blot applications at a concentration of 1 μg/ml.

Ações bioquímicas/fisiológicas

SMARCAD1 belongs to the SNF2/RAD54 helicase family. It contains 2 CUE domains, 1 helicase ATP-binding domain, and 1 helicase C-terminal domain. It is a probable ATP-dependent DNA helicase.

Sequência

Synthetic peptide located within the following region: RANTPDSDITEKTEDSSVPETPDNERKASISYFKNQRGIQYIDLSSDSED

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Janna Nousbeck et al.
American journal of human genetics, 89(2), 302-307 (2011-08-09)
Monogenic disorders offer unique opportunities for researchers to shed light upon fundamental physiological processes in humans. We investigated a large family affected with autosomal-dominant adermatoglyphia (absence of fingerprints) also known as the "immigration delay disease." Using linkage and haplotype analyses
Thomas Costelloe et al.
Nature, 489(7417), 581-584 (2012-09-11)
Several homology-dependent pathways can repair potentially lethal DNA double-strand breaks (DSBs). The first step common to all homologous recombination reactions is the 5'-3' degradation of DSB ends that yields the 3' single-stranded DNA required for the loading of checkpoint and

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica