Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV32533

Sigma-Aldrich

Anti-SPDEF (AB1) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Spdef Antibody, Spdef Antibody - Anti-SPDEF (AB1) antibody produced in rabbit, Anti-PDEF, Anti-RP11-375E1__A.3, Anti-SAM pointed domain containing ets transcription factor, Anti-bA375E1.3

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

37 kDa

reatividade de espécies

bovine, rabbit, human, dog, guinea pig

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SPDEF(25803)

Descrição geral

Rabbit polyclonal anti-SPDEF (AB1) antibody reacts with human, mouse, rat, bovine, pig, and canine SAM pointed domain containing ets transcription factors.
SAM pointed domain containing ets transcription factor (SPDEF, PDEF) is involved in the regulation of terminal differentiation of goblet/Paneth progenitor cells into intestinal Paneth and goblet cells. SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6.
SPDEF suppresses the metastasis of prostate cancer and modulates goblet cell hyperplasia in airway epithelial cells.
Rabbit Anti-SPDEF (AB1) antibody recognizes human, mouse, rat, bovine, pig, and canine SPDEF.

Imunogênio

Synthetic peptide directed towards the middle region of human SPDEF

Aplicação

Rabbit Anti-SPDEF (AB1) antibody can be used for western blot applications at a concentration of 1μg/ml.
Rabbit polyclonal anti-SPDEF (AB1) antibody is used to tag SAM pointed domain containing ets transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of SAM pointed domain containing ets transcription factor in the differentiation of Paneth and goblet cells and mucin production.

Ações bioquímicas/fisiológicas

PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequência

Synthetic peptide located within the following region: ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Giuseppe Lo Sasso et al.
PloS one, 9(7), e102495-e102495 (2014-07-12)
Dysfunction of Paneth and goblet cells in the intestine contributes to inflammatory bowel disease (IBD) and colitis-associated colorectal cancer (CAC). Here, we report a role for the NAD+-dependent histone deacetylase SIRT1 in the control of anti-bacterial defense. Mice with an
Joshua J Steffan et al.
The Journal of biological chemistry, 287(35), 29968-29978 (2012-07-05)
Emerging evidence suggests that the SAM pointed domain containing ETS transcription factor (SPDEF) plays a significant role in tumorigenesis in prostate, breast, colon, and ovarian cancer. However, there are no in vivo studies with respect to the role of SPDEF
Kwon-Sik Park et al.
The Journal of clinical investigation, 117(4), 978-988 (2007-03-10)
Goblet cell hyperplasia and mucous hypersecretion contribute to the pathogenesis of chronic pulmonary diseases including cystic fibrosis, asthma, and chronic obstructive pulmonary disease. In the present work, mouse SAM pointed domain-containing ETS transcription factor (SPDEF) mRNA and protein were detected
Xin-Hua Cheng et al.
PLoS genetics, 10(9), e1004656-e1004656 (2014-09-26)
SAM-pointed domain-containing ETS transcription factor (SPDEF) is expressed in normal prostate epithelium. While its expression changes during prostate carcinogenesis (PCa), the role of SPDEF in prostate cancer remains controversial due to the lack of genetic mouse models. In present study

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica