AV32135

Anti-MyF6 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-MRF4, Anti-Myogenic factor 6 (herculin)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 27 kDa
• reatividade de espécies: mouse, guinea pig, sheep, rabbit, horse, rat, goat, bovine, dog, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_002460
• nº de adesão UniProt: P23409
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... MYF6(4618)

Descrição

Descrição geral

MyF6 is a possible helix-loop-helix protein that may be involved in muscle differentiation. It is known to have conserved DNA binding and dimerization domains.
Rabbit Anti-MyF6 antibody recognizes canine, human, mouse, rat, bovine, zebrafish, pig, and chicken MyF6.

Imunogênio

Synthetic peptide directed towards the N terminal region of human MYF6

Aplicação

Rabbit Anti-MyF6 antibody can be used for western blot applications at a concentration of 1μg/ml.

Ações bioquímicas/fisiológicas

MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.

Sequência

Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable