Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

AV13056

Sigma-Aldrich

Anti-RAB3A antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-RAB3A, member RAS oncogene family

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

25 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_002857

nº de adesão UniProt

P20336

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... RAB3A(5864)

Imunogênio

Synthetic peptide directed towards the C terminal region of human RAB3A

Aplicação

Anti- RAB3D antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Ações bioquímicas/fisiológicas

Rab3A is a synaptic vesicle-associated GTPase that regulates Ca+2-dependent exocytosis. It is ubiquitously present in nervous system and in the acrosomal region of human sperm. Rab3A forms complex with RIM and Munc13 proteins to regulate synaptic vesicles docking and acrosomal exocytosis. It is a regulator of Ca+2-dependent release of α-melanocyte stimulating hormone.

Sequência

Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Simon Sedej et al.
PloS one, 8(10), e78883-e78883 (2013-11-10)
Rab3a is a small GTPase of the Rab3 subfamily that acts during late stages of Ca²⁺-regulated exocytosis. Previous functional analysis in pituitary melanotrophs described Rab3a as a positive regulator of Ca²⁺-dependent exocytosis. However, the precise role of the Rab3a isoform
Miao Tian et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 32(20), 6931-6936 (2012-05-18)
Rab3A is a synaptic vesicle-associated protein found throughout the nervous system, but its precise function is unknown. Genetic knock-out studies show that Rab3A is not necessary for vesicular release or replenishment at conventional synapses in the brain. Here we explore
Oscar D Bello et al.
Experimental cell research, 318(5), 478-488 (2012-01-18)
Exocytosis is a highly regulated, multistage process consisting of multiple functionally definable stages, including recruitment, targeting, tethering, priming, and docking of secretory vesicles with the plasma membrane, followed by calcium-triggered membrane fusion. The acrosome reaction of spermatozoa is a complex
Jun-Kyum Kim et al.
Molecular biology reports, 41(9), 5903-5911 (2014-06-27)
The Rab protein family is composed of small GTP-binding proteins involved in intracellular vesicle trafficking. In particular, Rab3a which is one of four Rab3 proteins (a, b, c, and d isoforms) is associated with synaptic vesicle trafficking in normal brain.

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica