613571

TIRAP Inhibitor Peptide, Control, Cell-Permeable

The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.

• Sinônimo(s): TIRAP Inhibitor Peptide, Control, Cell-Permeable, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap _151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL), Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap_151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
• Fórmula empírica (Notação de Hill): C₁₆₃H₂₆₈N₅₂O₃₈S
• Peso molecular: 3596.26
• Código UNSPSC: 12352202
• NACRES: NA.77

Propriedades

• Nível de qualidade: 100
• Ensaio: ≥97% (HPLC)
• Formulário: lyophilized solid
• fabricante/nome comercial: Calbiochem^®
• condição de armazenamento: OK to freeze; desiccated (hygroscopic); protect from light
• cor: white
• solubilidade: DMSO: 5 mg/mL
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C

Descrição

Descrição geral

A cell-permeable synthetic peptide containing mouse TIRAP_151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).

A cell-permeable synthetic peptide containing mouse toll-interleukin 1 receptor (TIR) domain-containing adapter protein 151-138 reverse sequence (TIRAP; also called Mal (MyD88-adapter-like), fused to the Drosophila antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).

Ações bioquímicas/fisiológicas

Cell permeable: yes

Primary Target
Control for TIRAP inhibitor

Product does not compete with ATP.

Reversible: no

Embalagem

Packaged under inert gas

Advertência

Toxicity: Standard Handling (A)

Sequência

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH

forma física

Supplied as a trifluoroacetate salt.

Reconstituição

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Outras notas

Horng, T., et al. 2001. Nat. Immunol.2, 835.

Informações legais

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable