WH0387129M1

Monoclonal Anti-GPR154 antibody produced in mouse

clone 2F5, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-G protein-coupled receptor 154, Anti-GPRA, Anti-PGR14, Anti-VRR1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2F5, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: NM_207173
• Numéro d'accès UniProt: Q6W5P4
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NPSR1(387129)

Description

Description générale

This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. (provided by RefSeq)

Immunogène

GPR154 (NP_997056, 2 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL

Actions biochimiques/physiologiques

G protein-coupled receptor 154 (GPR154) is involved in processes like nociception and inflammation. Polymorphisms in the gene encoding it are linked to asthma and chronic inflammatory diseases.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)