Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

WH0117581M1

Sigma-Aldrich

Monoclonal Anti-TWIST2 antibody produced in mouse

clone 3C8, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-DERMO1, Anti-MGC117334, Anti-twist homolog 2 (Drosophila)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3C8, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Application(s)

research pathology

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TWIST2(117581)

Description générale

Twist family bHLH transcription factor 2 (TWIST2) is part of the basic helix-loop-helix protein (bHLH) family. It acts as a molecular switch by activating or repressing target genes. The TWIST2 gene is localized on human chromosome 2q37.3.

Immunogène

TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH

Application

Monoclonal Anti-TWIST2 antibody produced in mouse has been used in immunohistochemistry.

Actions biochimiques/physiologiques

Twist family bHLH transcription factor 2 (TWIST2) modulates transcription in mesenchymal cell lineages during development. It interacts with E-protein modulators and binds with E-box on DNA sequences. Mutations in the TWIST2 gene have been linked with Setleis syndrome.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Biological function and molecular mechanism of Twist2.
Chengxiao Z and Ze Y
Yi Chuan = Hereditas / Zhongguo yi Chuan Xue Hui Bian ji, 37(1), 17-24 (2015)
Clinical Description, Molecular Analysis of TWIST2 Gene, and Surgical Treatment in a Patient With Barber-Say Syndrome.
Zuazo F
Ophthalmic Plastic and Reconstructive Surgery (2018)
Coexpression of Bcl-2 with epithelial?mesenchymal transition regulators is a prognostic indicator in hepatocellular carcinoma
Nan Zhao
Medical Oncology (Northwood, London, England) (2012)
Masanori Murakami et al.
Development, growth & differentiation, 50(2), 121-130 (2008-01-24)
Transforming growth factor-beta (TGF-beta) has been demonstrated to inhibit myogenesis in myoblasts. Here we report that transcriptional upregulation of p21(WAF1/Cip1) and muscle creatinine kinase (MCK) genes in C2C12 cells, which are associated with growth arrest at the G1 phase and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique