WH0010298M1

Monoclonal Anti-PAK4 antibody produced in mouse

clone 3F10, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-p21(CDKN1A)-activated kinase 4
• Numéro MDL: MFCD04118638
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3F10, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC002921
• Numéro d'accès UniProt: O96013
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PAK4(10298)

Description

Description générale

PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)

PAK4 (p21 (RAC1) activated kinase 4) belongs to the group II PAK serine/threonine kinases family. It has an N‐terminal regulatory domain and a C‐terminal kinase domain. This gene is located on human chromosome 19q13.2.

Immunogène

PAK4 (AAH02921, 68 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD

Actions biochimiques/physiologiques

PAK4 (p21 (RAC1) activated kinase 4) is required for the viability of embryos and growth of tissues. It induces the development of cancer in vitro and in vivo. This protein plays a major role in the multiplication of cells in embryogenesis. PAK4 controls cytoskeletal dynamics, in GPR40-dependent potentiation of insulin secretion.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)