Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

WH0009075M1

Sigma-Aldrich

Monoclonal Anti-CLDN2 antibody produced in mouse

clone 3F1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-claudin 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Numéro MDL:
MFCD03454910
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3F1, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_020384

Numéro d'accès UniProt

P57739

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CLDN2(9075)

Catégories apparentées

Description générale

Claudin-2 (CLDN2) is one of the pore-forming claudins and is a member of the claudin family of proteins. It is present in the proximal tubules and the gene encoding it is localized on human chromosome Xq22.

Immunogène

CLDN2 (NP_065117, 29 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA

Actions biochimiques/physiologiques

Claudin-2 (CLDN2) controls paracellular permeability and maintains cell polarity in epithelial and endothelial cell sheets. In MDCK (madin-darby canine kidney cells), claudin-2 participates in the generation of aqueous pores with high conductance.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Inhibition of Autophagic Degradation Process Contributes to Claudin-2 Expression Increase and Epithelial Tight Junction Dysfunction in TNF-a Treated Cell Monolayers
Cong Zhang
International Journal of Molecular Sciences (2017)
Tumor necrosis factor-a induces a biphasic change in claudin-2 expression in tubular epithelial cells: role in barrier functions
Yasaman Amoozadeh
American Journal of Physiology. Cell Physiology (2015)
Conversion of Zonulae Occludentes from Tight to Leaky Strand Type by Introducing Claudin-2 into Madin-Darby Canine Kidney I Cells
Mikio Furuse
The Journal of Biological Chemistry (2001)
The claudins
Madhu Lal-Nag and Patrice J Morin
Genome Biology (2009)
Ágnes Holczbauer et al.
Pathology oncology research : POR, 20(3), 493-502 (2014-04-04)
Claudins have been reported to be differentially regulated in malignancies and implicated in the process of carcinogenesis and tumor progression. Claudin-1 has been described as key factor in the entry of hepatitis C virus (HCV) into hepatocytes and as promoter

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique