Accéder au contenu
Merck
Toutes les photos(7)

Principaux documents

WH0008805M1

Sigma-Aldrich

Monoclonal Anti-TRIM24 antibody produced in mouse

clone 2F2, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-PTC6, Anti-RNF82, Anti-TF1A, Anti-TIF1, Anti-TIF1A, Anti-TIF1ALPHA, Anti-hTIF1, Anti-tripartite motif-containing 24

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2F2, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG3κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TRIM24(8805)

Description générale

Tripartite motif-containing 24 (TRIM24) is a co-regulator that belongs to the transcription intermediary factor 1 family. It is also known as transcription intermediary factor 1α (TIF1α). TRIM24 has an amino-terminal RING-B boxes-coiled coil (RBCC/TRIM) motif, a carboxy-terminal plant homeodomain (PHD) finger-bromodomain unit and a nuclear receptor interaction box (NR box or LXXLL motif). This gene is located on human chromosome 7q33-q34.

Immunogène

TRIM24 (AAH28689, 432 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW

Actions biochimiques/physiologiques

Tripartite motif-containing 24 (TRIM24) acts as a potential prognostic biomarker for ESCC (esophageal squamous cell cancer). This protein induces the development of tumor and generates chemotherapy resistance through the phosphatidylinositide 3-kinase (PI3K)/Akt pathway. TRIM24 modulates p53 protein levels by changing the stability of p53.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Trim24 targets endogenous p53 for degradation.
Allton K, et al.
Proceedings of the National Academy of Sciences of the USA, 106(28), 11612-11616 (2009)
Clinical significance and prognostic value of TRIM24 expression in esophageal squamous cell carcinoma
Chi J, et al.
Aging (Albany. NY.), 8(9), 2204-2221 (2016)
Genomic analysis of the TRIM family reveals two groups of genes with distinct evolutionary properties
Sardiello M, et al.
BMC Evolutionary Biology (2008)
Jianwei Wang et al.
Oncology research, 22(1), 39-45 (2015-02-24)
Colorectal cancer remains one of the most common cancers in men and women, and it accounts for a large proportion of cancer-related deaths worldwide. Tripartite motif (TRIM) proteins are a novel class of "single protein RING finger" E3 ubiquitin ligases

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique