WH0007976M9

Monoclonal Anti-FZD3 antibody produced in mouse

clone 2H5, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-Fz3, Anti-frizzled homolog 3 (Drosophila), Anti-hFz3
• Numéro MDL: MFCD06798445
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2H5, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: NM_017412
• Numéro d'accès UniProt: Q9NPG1
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FZD3(7976)

Description

Description générale

Frizzled class receptor 3 (FZD3) is a receptor with seven-transmembrane domains and it is expressed in human melanocytes. The gene encoding it is localized on human chromosome 8p21.1.

Immunogène

FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV

Actions biochimiques/physiologiques

Frizzled class receptor 3 (FZD3) modulates the growth of longitudinal axon tracts in the central nervous system. It mediates the dynamics of axon within the enteric, sympathetic and peripheral nervous systems. FZD3 regulates planar cell polarity. Abnormal FZD3 gene methylation causes chromatin structure modifications, associated with congenital hydrocephalus. Mutation in FZD3 gene is associated with Hirschsprung disease, a birth defect lacking the intrinsic ganglion cells of the lower intestine.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)