Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

WH0004684M1

Sigma-Aldrich

Monoclonal Anti-NCAM1 antibody produced in mouse

clone 3G12, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-CD56, Anti-MSK39, Anti-NCAM, Anti-neural cell adhesion molecule 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3G12, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

BC047244

Numéro d'accès UniProt

P13591

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NCAM1(4684)

Description générale

Neural cell adhesion molecule (NCAM/CD56) is a calcium-independent binding protein. It is located on human chromosome 11q23.1. This molecule belongs to the immunoglobulin superfamily. NCAM1 is present in neurons and glial cells.

Immunogène

NCAM1 (AAH47244, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP

Actions biochimiques/physiologiques

Neural cell adhesion molecule (NCAM/CD56) participates in homophilic cell–cell and heterophilic cell–matrix interactions. It controls the movement of cells and condensation during skeletal development. This protein participates in synaptic plasticity, neurodevelopment and neurogenesis.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

En option

Réf. du produit
Description
Tarif

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

NCAM1 association study of bipolar disorder and schizophrenia: polymorphisms and alternatively spliced isoforms lead to similarities and differences
Atz ME, et al.
Psychiatric Genetics, 17(2), 55-67 (2007)
Expression of neural cell adhesion molecule and polysialic acid in human bone marrow-derived mesenchymal stromal cells
Skog MS, et al.
Stem Cell Research & Therapy, 7(1), 113-113 (2016)
Syh-Jae Lin et al.
Immunologic research, 60(1), 105-111 (2014-02-12)
CD4(+)CD25(+) regulatory T cells (Treg), if properly expanded from umbilical cord blood (UCB), may provide a promising immunotherapeutic tool. Our previous data demonstrated that UCB CD4(+)CD25(+) T cells with 4-day stimulation have comparable phenotypes and suppressive function to that of
Tomoko Ohtani et al.
International journal of oncology, 45(5), 2051-2057 (2014-08-15)
Conventional cancer treatments are surgery, radiotherapy, and chemotherapy, but treatment efficiency is insufficient and cancer recurrence is common. Immunotherapy has been added as an important cancer treatment component, but no reports on its efficacy in oral and maxillofacial cancers exist.
Sanna Hämäläinen et al.
Journal of medical virology, 86(8), 1412-1420 (2014-03-13)
Enterovirus infections are usually mild but can also cause severe illnesses and play a role in chronic diseases, such as cardiomyopathies and type 1 diabetes. Host response to the invading virus can markedly modulate the course of the infection, and
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique