WH0003673M1
Monoclonal Anti-ITGA2 antibody produced in mouse
clone 2B6, purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
Anti-BR, Anti-CD49B, Anti-GPIa, Anti-VLA2, Anti-VLAA2, Anti-integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
mouse
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
2B6, monoclonal
Forme
buffered aqueous solution
Espèces réactives
human
Technique(s)
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
Isotype
IgG1κ
Numéro d'accès GenBank
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... ITGA2(3673)
Description générale
Integrin α2 (ITGA2) is a collagen receptor that is present on the platelets and epithelial cells. This protein is highly expressed in normal epithelial cells. The ITGA2 gene is located on the human chromosome at 5q11.2.
Immunogène
ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
Sequence
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
Actions biochimiques/physiologiques
Integrin α2 subunit (ITGA2) plays a role in angiogenesis, cell migration, invasion, and cell survival. This protein acts as a tumor activator in several tumors. ITGA2 protein might be involved in cell adhesion and cell-surface mediated signaling and is highly expressed in several cancers. Overexpression of the ITGA2 gene is observed in pancreatic ductal adenocarcinoma and ovarian cancer.
Integrin subunit α 2 (ITGA2) functions as a platelet receptor of collagen, which is an important activating agent required for platelet aggregation. Mutation in the gene might lead to aspirin insensitivity mainly in Chinese populations and in aspirin semi-resistance. Integrin α2β1 serves as a receptor for collagen and many other extracellular matrix (ECM) complexes. Variation in the gene elevates the expression of α2β1 on platelets and increase the risk of having melanoma, gastric, ovarian cancer, thrombosis, myocardial infarction and stroke. Thus, Integrin α2β1 acts as a potential therapeutic target for thrombosis related diseases, cancer, and inflammation. Cryptosporidium parvum infection, elevates the expression of ITGA2 in the host cell. Therefore, silencing the expression of the ITGA2 by using specific antibodies and the ligand type I collagen (collagen-I), is considered as a promising therapeutic method for treatment of cryptosporidial infection.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Informations légales
GenBank is a registered trademark of United States Department of Health and Human Services
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Integrin a2 (ITGA2)
Jyrki Heino
Encyclopedia of Signaling Molecules, 962-966 null
Liang Zhang et al.
Pathology oncology research : POR, 25(4), 1545-1552 (2018-12-06)
ITGA2 (Integrin alpha-2) has been detected to be over-expressed in a number of cancers and has been suggested to be involved in cell adhesion and cell-surface mediated signaling. Our previous study using bioinformatic analyses has shown that ITGA2 might be
Linlin Ma et al.
Aging, 12(6), 5336-5351 (2020-03-24)
Ovarian cancer is one of the most malignant tumors of the female reproductive system, with high invasiveness. The disease is a severe threat to women's health. The ITGA2 gene, which codes for integrin subunit α2, is involved in the proliferation
Haili Zhang et al.
Infection and immunity, 80(5), 1753-1758 (2012-02-23)
Cryptosporidium parvum is an opportunistic pathogen in AIDS patients. It is an intracellular but extracytoplasmic parasite residing in a host cell-derived parasitophorous vacuole. It is still poorly understood how this parasite interacts with host cells. We observed that expression of
Wen Ding et al.
PloS one, 10(8), e0135128-e0135128 (2015-08-11)
The loss of ITGA2 plays an important role in cancer metastasis in several solid cancers. However, the molecular mechanism of ITGA2 loss in primary cancers remains unclear. In this study, we found that a lower ITGA2 protein level was observed
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique