Accéder au contenu
Merck
Toutes les photos(7)

Principaux documents

WH0003170M1

Sigma-Aldrich

Monoclonal Anti-FOXA2 antibody produced in mouse

clone 7E6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-HNF3B, Anti-MGC19807, Anti-TCF3B, Anti-forkhead box A2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

7E6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FOXA2(3170)

Description générale

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq)

Immunogène

FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

Actions biochimiques/physiologiques

Forkhead box A2 (FOXA2) expressed in the liver, pancreas, intestine, and lungs, is associated with embryonic formation of the primitive streak and endoderm. It also plays an important role in airway epithelial differentiation and is extensively expressed in type II pneumocytes. Decreased expression of Foxa2 is observed in lung cancer and non-small-cell lung cancer (NSCLC). FOXA2 plays a vital role in normal pancreatic β-cell function, therefore, aberration in the expression of the gene leads to hyperinsulinemic hypoglycemia. FOXA2 also has an essential role in pancreatic α-cell differentiation. FOXA2 expressed along with FOXA1 in the foregut endoderm plays a vital role in liver, hepatic and neuronal development, these factors also have an overlapping role in lung morphogenesis. FOXA2 acts a regulator of the network of gene associated with the intestinal epithelial cell function. Increased expression of FOXA2 in MKN-45 cells (human gastric cancer cell line) elevates E-cadherin expression and inhibits gastric cancer cell migration and invasion and therefore, FOXA2 is expressed at low levels in gastric adenocarcinoma tissues.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Zhengliang Zhang et al.
Xi bao yu fen zi mian yi xue za zhi = Chinese journal of cellular and molecular immunology, 31(5), 672-676 (2015-05-06)
To investigate the expression of FOXA2 in human gastric adenocarcinoma and its correlation with cell migration and invasion. Fifty-six pairs of gastric adenocarcinoma and matched tumor-adjacent tissues were freshly collected. The expressions of FOXA2 and epithelial cadherin (E-cadherin) in the
Daniela S Basseres et al.
Lung cancer (Amsterdam, Netherlands), 77(1), 31-37 (2012-02-22)
We sought to determine the mechanisms of downregulation of the airway transcription factor Foxa2 in lung cancer and the expression status of Foxa2 in non-small-cell lung cancer (NSCLC). A series of 25 lung cancer cell lines were evaluated for Foxa2
Catherine S Lee et al.
Developmental biology, 278(2), 484-495 (2005-02-01)
The differentiation of insulin-producing beta-cells has been investigated in great detail; however, little is known about the factors that delineate the second-most abundant endocrine lineage, the glucagon-producing alpha-cell. Here we utilize a novel YAC-based Foxa3Cre transgene to delete the winged
Nehal Gosalia et al.
Physiological genomics, 47(7), 290-297 (2015-04-30)
The forkhead box A (FOXA) family of pioneer transcription factors is critical for the development of many endoderm-derived tissues. Their importance in regulating biological processes in the lung and liver is extensively characterized, though much less is known about their

Global Trade Item Number

RéférenceGTIN
WH0003170M1-100UG4061831633320

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique