Accéder au contenu
Merck
Toutes les photos(7)

Key Documents

WH0001958M3

Sigma-Aldrich

Monoclonal Anti-EGR1 antibody produced in mouse

clone 6E8, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-AT225, Anti-G0S30, Anti-KROX24, Anti-NGFIA, Anti-TIS8, Anti-ZIF268, Anti-ZNF225, Anti-early growth response 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(7)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

6E8, monoclonal

Forme

buffered aqueous solution

Espèces réactives

mouse

Technique(s)

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_001964

Numéro d'accès UniProt

P08046

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... EGR1(1958)

Description générale

Early-growth response 1 gene (EGR1) is encoded by the gene mapped to human chromosome 5q31.2. The gene codes for a member of the WT-1 family of transcription factors, which contains three Cys2His2 Zn fingers.
The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. (provided by RefSeq)

Immunogène

EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Actions biochimiques/physiologiques

Early-growth response 1 gene (EGR1) facilitates the cellular response to mitogens, stress stimuli and growth factors. It also functions as a tumor suppressor gene in various human cancers. In addition, EGR1 is implicated in the direct regulation of several tumor suppressors such as transforming growth factor β1(TGFβ1), phosphatase and tensin homolog (PTEN), p53 and fibronectin. Mutation in the gene is associated with the development of myeloid disorders.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

The transcription factor Egr1 is a direct regulator of multiple tumor suppressors including TGFbeta1, PTEN, p53, and fibronectin.
Baron V, et al.
Cancer Gene Therapy, 13, 115-124 (2006)
Haploinsufficiency of EGR1, a candidate gene in the del(5q), leads to the development of myeloid disorders.
Joslin JM, et al.
Blood, 110, 719-726 (2007)
Genomic Organization and Chromosomal Localization of the Human Histone Deacetylase 3 Gene
Mahlknecht U, et al.
Genomics, 56, 197-202 (1999)
Tepmanas Bupha-Intr et al.
American journal of physiology. Heart and circulatory physiology, 293(6), H3759-H3767 (2007-10-16)
To study myocardial hypertrophy under in vitro conditions, we developed an experimental system and protocol in which mechanical conditions of isolated multicellular myocardium can be controlled while function can be continuously assessed. This in vitro culture system now allows us
Sarah A Stern et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 39(9), 2179-2190 (2014-03-20)
To treat cognitive disorders in humans, new effective therapies that can be easily delivered systemically are needed. Previous studies showed that a bilateral injection of insulin-like growth factor II (IGF-II) into the dorsal hippocampus of rats or mice enhances fear

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique