SAB5703016

Anti-Thioredoxin reductase 2 (TXNRD2 ) Antibody, clone 4O1K0, Rabbit Monoclonal

• Synonyme(s) : SELZ, TR, TR-BETA, TR3, TRXR2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 4O1K0, monoclonal
• Forme: liquid
• Poids mol.: 56 kDa
• Espèces réactives: rat, human, rat
• Concentration: 0.79 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQA
• Numéro d'accès UniProt: Q9NNW7
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TXNRD2(10587)

Description

Description générale

This gene encodes a member of the class I pyridine nucleotide-disulfide oxidoreductase family. The encoded protein is a selenocysteine-containing flavoenzyme that maintains thioredoxins in a reduced state, thereby playing a key role in regulating the cellular redox environment. Mammals have three related thioredoxin reductases. This gene encodes a mitochondrial form important for scavenging of reactive oxygen species in mitochondria. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Sep 2013]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin reductase 2 (TXNRD2 ) (Q9NNW7).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1