SAB5702918

Anti-S100A10 Antibody, clone 6X8F7, Rabbit Monoclonal

• Synonyme(s) : 42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, P11, p10
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 6X8F7, monoclonal
• Forme: liquid
• Poids mol.: 11 kDa
• Espèces réactives: human, rat, rat
• Concentration: 0.23 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
• Numéro d'accès UniProt: P60903
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... S100A10(6281)

Description

Description générale

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq, Jul 2008]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-97 of human S100A10 (P60903).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC, IF/ICC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1