SAB5702818

Anti-S100P Antibody, clone 1E1M2, Rabbit Monoclonal

• Synonyme(s) : MIG9
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 1E1M2, monoclonal
• Forme: liquid
• Poids mol.: 9 kDa
• Espèces réactives: human
• Concentration: 1.00 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:1000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
• Numéro d'accès UniProt: P25815
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... S100P(6286)

Description

Description générale

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer.

Immunogène

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1).

Application

WB, IF/ICC

Informations sur la sécurité

• Pictogrammes: GHS07,GHS09
• Mention d'avertissement: Warning
• Mentions de danger: H317,H411
• Conseils de prudence: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classification des risques: Aquatic Chronic 2 - Skin Sens. 1
• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3