SAB5702784

Anti-GABARAPL2 Antibody, clone 8Z8M8, Rabbit Monoclonal

• Synonyme(s) : ATG8, ATG8C, GATE-16, GATE16, GEF-2, GEF2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 8Z8M8, monoclonal
• Forme: liquid
• Poids mol.: 16 kDa
• Espèces réactives: human, rat, rat
• Concentration: 0.3 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: GSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
• Numéro d'accès UniProt: P60520
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... GABARAPL2(11345)

Description

Description générale

Ubiquitin-like modifier involved in intra-Golgi traffic (By similarity. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation (By similarity. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 (By similarity. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 38-117 of human GABARAPL2 (P60520).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1