SAB5702782

Anti-FOXP1 Antibody, clone 2Q1R5, Rabbit Monoclonal

• Synonyme(s) : 12CC4, HSPC215, MFH, QRF1, hFKH1B
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 2Q1R5, monoclonal
• Forme: liquid
• Poids mol.: 70-90 kDa
• Espèces réactives: rat, human, rat
• Concentration: 0.5mg/ml
• Technique(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:100 - 1:500; western blot: 1:1000 - 1:3700
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: SGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLS
• Numéro d'accès UniProt: Q9H334
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FOXP1(27086)

Description

Description générale

This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 550-650 of human FOXP1 (Q9H334).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC, IF/ICC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1