SAB5702135

Anti-SMG1 Antibody, clone 5N10C7, Rabbit Monoclonal

• Synonyme(s) : ATX, LIP, SMG1 phosphatidylinositol 3-kinase-related kinase
• Code UNSPSC : 12352203

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 5N10C7, monoclonal
• Forme: liquid
• Poids mol.: 340 kDa
• Espèces réactives: rat, human, rat
• Concentration: 0.75 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: LIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
• Numéro d'accès UniProt: Q96Q15
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... Smg1(23049)

Description

Description générale

This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternatively spliced transcript variants have been described, but their full-length nature has yet to be determined.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 3562-3661 of human SMG1 (Q96Q15).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1