Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB5201357

Sigma-Aldrich

Monoclonal Anti-Ataxin - Atto 390 antibody produced in mouse

clone S76-8, purified immunoglobulin

Synonyme(s) :

Anti-ATX1, Anti-D6S504E, Anti-Spinocerebellar ataxia type 1 protein

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

Atto 390 conjugate

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

S76-8, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen predicted mol wt 85 kDa

Espèces réactives

human, mouse, rat

Concentration

1 mg/mL

Technique(s)

immunohistochemistry: suitable
immunoprecipitation (IP): suitable
western blot: suitable

Isotype

IgG2b

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

mouse ... Atxn1(20238)

Immunogène

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

PBS pH 7.4, 50% glycerol, 0.1% sodium azide

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Nanoscale organization of nicotinic aceylcholine receptors by stimulated emission depletion microscopy.
Neuroscience, 144(1), 135-143 (2007)
Stimulated emission depletion-based raster image correlation spectroscopy reveals biomolecular dynamics in live cells.
Hedde P.N.; et al.
Nature Communications, 4, 2093-2093 (2013)
Munc18-1 Tuning of Vesicle Merger and Fusion Pore Properties.
Jorgacevski, J.; et al.
The Journal of Neuroscience, 31(24), 9055-9066 (2011)
SNARE Function Is Not Involved in Early Endosome Docking.
Geumann, U.; et al.
Molecular Biology of the Cell, 19(12), 5327-5337 (2008)
STED Nanoscopy in Living Cells Using Fluorogen Activating Proteins.
Fitzpatrick, JA.; et al.
Bioconjugate Chemistry, 20(10), 1843-1847 (2009)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique