SAB2108825

Anti-CPT1B antibody produced in rabbit HRP conjugated

affinity isolated antibody

• Code UNSPSC : 12352203

Propriétés

• Source biologique: rabbit
• Conjugué: peroxidase conjugate
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 88 kDa
• Réactivité de l'espèce (prédite par homologie): guinea pig, zebrafish, human, bovine, rat, horse, rabbit, mouse, canine
• Concentration: 0.5 mg/mL
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
• Numéro d'accès NCBI: NM_004377
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CPT1B(1375)

Description

Description générale

The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-

Immunogène

Synthetic peptide directed towards the middle region of human CPT1B

Séquence

Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA

Forme physique

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 12 - Non Combustible Liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable