Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

SAB2108746

Sigma-Aldrich

Anti-MLKL

affinity isolated antibody

Synonyme(s) :

Anti-FLJ34389

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

54 kDa

Espèces réactives

human

Concentration

0.5-1 mg/mL

Technique(s)

immunoblotting: suitable

Numéro d'accès

NM_152649

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MLKL(197259)

Description générale

Mixed lineage kinase domain-like protein (MLKL) is encoded by the gene mapped to human chromosome 16q23. Activated MLKL is localized on the cell membrane.

Immunogène

Synthetic peptide directed towards the N terminal region of human MLKL

Actions biochimiques/physiologiques

Mixed lineage kinase domain-like protein (MLKL) primarily causes receptor-interacting protein (RIP) kinase–dependent necroptosis. However, during hepatitis, it results in programmed hepatocellular necrosis which is independent of RIPK3.s MLKL also participates in endosomal trafficking and in the formation of extracellular vesicles.

Séquence

Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Genetic changes associated with testicular cancer susceptibility.
Pyle LC and Nathanson KL
Seminars in Oncology, 43, 575-575 (2016)
The pseudokinase MLKL mediates programmed hepatocellular necrosis independently of RIPK3 during hepatitis.
Gunther C
The Journal of Clinical Investigation, 126, 4346-4346 (2016)
MLKL, the Protein that Mediates Necroptosis, Also Regulates Endosomal Trafficking and Extracellular Vesicle Generation.
Yoon S
Immunity, 47, 51-51 (2017)
MLKL Activation Triggers NLRP3-Mediated Processing and Release of IL-1? Independently of Gasdermin-D.
Gutierrez KD
Journal of Immunology, 198, 2156-2156 (2017)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique