Accéder au contenu
Merck
Toutes les photos(4)

Key Documents

SAB2108342

Sigma-Aldrich

Anti-SGK1 antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

49kDa

Espèces réactives

guinea pig, rabbit, bovine, human, mouse, rat, dog, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SGK1(6446)

Catégories apparentées

Description générale

SGK1 (serum/glucocorticoid regulated kinase 1) codes for a serine/threonine kinase and it is structurally and functionally homologous to kinases of AKT (protein kinase B) family. SGK1 is ubiquitously expressed in all tissues and is predominant in kidney. The SKG1 gene is mapped to human chromosome 6q23.2.

Immunogène

Synthetic peptide directed towards the N terminal region of human SGK1

Actions biochimiques/physiologiques

The SGK1 (serum/glucocorticoid regulated kinase 1) gene is associated with a number of pathophysiological processes such as autophagy, ion transport, proliferation, metabolic, inflammation, syndrome and endoplasmic reticulum stress. Cellular dehydration, increased extracellular salt concentration, hormones such as glucocorticoids, mineralocorticoids, transforming growth factor β and mediators (cytokines) such as interleukin -6, stimulates SGK1 action. SGK1 gene expression is regulated by cellular signals involving cytosolic Ca2+, cyclic AMP (adenosine monophosphate), stress-activated protein kinase (SAPK2 (serine/threonine-protein kinase 2), p38 kinase), protein kinase C. Also, insulin and insulin-like growth factor, ERK (extracellular signal-regulated kinase) 1/2, and hepatic growth factor induces SGK1 transcription. Upregulation of SGK1 is observed in diabetes, liver cirrhosis, glomerulonephritis, dialysis and several tumors.

Séquence

Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

SGK1 inhibits PM2. 5-induced apoptosis and oxidative stress in human lung alveolar epithelial A549 cells.
Li J, et al.
Biochemical and Biophysical Research Communications, 496(4), 1291-1295 (2018)
Single nucleotide polymorphism microarray analysis in cortisol-secreting adrenocortical adenomas identifies new candidate genes and pathways.
Ronchi C L, et al.
Neoplasia, 14(3), 206-218 (2012)
Associations of the Serum/Glucocorticoid Regulated Kinase Genes With BP Changes and Hypertension Incidence: The Gensalt Study.
Zhang D, et al.
American Journal of Hypertension, 30(1), 95-101 (2016)
Lnc-SGK1 induced by Helicobacter pylori infection and highsalt diet promote Th2 and Th17 differentiation in human gastric cancer by SGK1/Jun B signaling.
Yao Y, et al.
Oncotarget, 7(15), 20549-20549 (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique