Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

SAB2108302

Sigma-Aldrich

Anti-HNF1A antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Conjugué:
unconjugated
application:
IHC
Clone:
polyclonal
Espèces réactives:
human, dog, mouse, guinea pig, horse, rat
citations:
4
Technique(s):
immunoblotting: suitable
immunohistochemistry: suitable

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

67kDa

Espèces réactives

human, dog, mouse, guinea pig, horse, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HNF1A(6927)

Description générale

Hepatocyte nuclear factor 1α (HNF1α) is a transcription factor that belongs to the liver enriched transcription factor family. It has a N-terminal dimerization domain (amino acids 1–32), a POU-homeobox DNA binding domain (amino acids 150-280) and a C-terminal transactivation domain (amino acids 281-631). HNF1A is located on human chromosome 12q24.

Immunogène

Synthetic peptide directed towards the N terminal region of human HNF1A

Actions biochimiques/physiologiques

HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5′-GTTAATNATTAAC-3′.
Hepatocyte nuclear factor 1α (HNF1α) modulates hepatocyte functions. It plays an important role in the modulation of gene expression and replication of hepatitis B virus (HBV). HNF1α is involved in lipid metabolism, gluconeogenesis and deoxygenation of xenobiotics. It stimulates the expression of the preS1 mRNA to induce the production of LHBs (viral large surface protein). Mutations in hepatocyte nuclear factor-1A (HNF1A) results in maturity-onset diabetes of the young type 3 (MODY3).

Séquence

Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Hepatocyte nuclear factor 1α downregulates HBV gene expression and replication by activating the NF-κB signaling pathway.
Lin J, et al.
PLoS ONE, 12(3), e0174017-e0174017 (2017)
The HNF1A mutant Ala180Val: Clinical challenges in determining causality of a rare HNF1A variant in familial diabetes.
Sagen JV, et al.
Diabetes Research and Clinical Practice, 133, 142-149 (2017)
p. Q511L mutation of HNF1? in hepatocellular carcinoma suppresses the transcriptional activity and the anti-tumor effect of HNF1α.
Ding CH, et al.
Biochemical and Biophysical Research Communications, 495(1), 86-91 (2018)
Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
Chasman DI, et al.
PLoS Genetics, 5(11), e1000730-e1000730 (2009)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique