Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB2107278

Sigma-Aldrich

Anti-DENND1A antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

111 kDa

Espèces réactives

rabbit, human, mouse

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

Description générale

DENN domain containing 1A (DENND1A) gene with 22 exons, spanning 500,000 bases on genomic DNA, is encoded by the gene mapped to human chromosome 9q22.32. DENND1A belongs to the family of 18 human genes, called “connecdenns”. The encoded protein contains clathrin-binding domain involved in endocytosis and receptor-mediated turnover.1 DENND1A is widely expressed, but at high levels in brain and kidneys.”

Immunogène

The immunogen for anti-DENND1A antibody: synthetic peptide derected towards the C terminal of human DENND1A

Actions biochimiques/physiologiques

DENN domain containing 1A (DENND1A) acts as a guanine nucleotide-exchange factor and plays a vital role in membrane trafficking by interacting with members of the Rab family of small guanosine triphosphatase (GTPases). The encoded protein interacts with lipids, mainly phosphoinositol-3-phosphate and other endocytosis/endosome proteins. DENND1A is also implicated in endosomal recycling and aberrations in the protein function might alter insulin secretion. Elevated expression/Mutation in the gene is associated with the development of polycystic ovary syndrome (PCOS).

Séquence

Synthetic peptide located within the following region: QPLGQAKSLEDLRAPKDLREQPGSFDYQRLDLCRSERGLSMAAALKLAHP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Association of DENND1A Gene Polymorphisms with Polycystic Ovary Syndrome: A Meta-Analysis.
Bao S
Journal of Clinical Research in Pediatric Endocrinology, 8(2), 135-143 (2016)
Yasuko Okano et al.
PloS one, 8(9), e73794-e73794 (2013-09-17)
The transcription factor NRF2 plays a pivotal role in protecting normal cells from external toxic challenges and oxidative stress, whereas it can also endow cancer cells resistance to anticancer drugs. At present little information is available about the genetic polymorphisms
Jan M McAllister et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(15), E1519-E1527 (2014-04-08)
Polycystic ovary syndrome (PCOS), characterized by increased ovarian androgen biosynthesis, anovulation, and infertility, affects 5-7% of reproductive-age women. Genome-wide association studies identified PCOS candidate loci that were replicated in subsequent reports, including DENND1A, which encodes a protein associated with clathrin-coated

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique