Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB2102776

Sigma-Aldrich

Anti-ZFYVE1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DFCP1, Anti-KIAA1589, Anti-TAFF1, Anti-ZNFN2A1, Anti-Zinc finger, FYVE domain containing 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

87 kDa

Espèces réactives

dog, human, guinea pig, horse, mouse, rat, rabbit, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ZFYVE1(53349)

Description générale

Zinc finger FYVE-type containing 1 (ZFYVE1) encodes a 777 amino acid protein, which consists a N terminal Cys-His cluster homologous to zinc finger domains and two zinc-binding FYVE domains at the C terminal. It also contains an ATP/GTP binding site. ZFYVE1 gene is located on human chromosome 14q22-q24.

Immunogène

Synthetic peptide directed towards the C terminal region of human ZFYVE1

Actions biochimiques/physiologiques

ZFYVE1 contains two zinc-binding FYVE domains in tandem. This protein binds to phosphatidylinositol-3-phosphate (PtdIns3P) through its FYVE-type zinc finger. It displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes.The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains two zinc-binding FYVE domains in tandem. This protein displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes. Zinc finger FYVE-type containing 1 (ZFYVE1) organizes the endoplasmic reticulum around the phagophore to form a cradle like structure, which is called as an omegasome.

Séquence

Synthetic peptide located within the following region: VCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Genetic aberrations in macroautophagy genes leading to diseases
van Beek N, et al.
Biochimica et Biophysica Acta - Molecular Cell Research (2018)
A R Derubeis et al.
Gene, 255(2), 195-203 (2000-10-12)
Double FYVE-containing protein 1 (DFCP1) encodes a 777 amino acid protein that contains: (1) an N-terminal Cys-His cluster with some homology to many zinc finger domains; (2) a consensus sequence consistent with an ATP/GTP binding site; and (3) a C-terminal

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique