SAB2101422

Anti-MAN1A2 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-MAN1B, Anti-Mannosidase, α, class 1A, member 2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 73 kDa
• Espèces réactives: bovine, mouse, rabbit, human, horse, dog, rat, guinea pig
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès UniProt: O60476
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MAN1A2(10905)

Description

Immunogène

Synthetic peptide directed towards the middle region of human MAN1A2

Actions biochimiques/physiologiques

Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-597 BC052954.1 17-613 598-1023 AU133800.1 118-543 1024-2908 AF027156.1 823-2707 2909-3316 BC052954.1 2925-3332 3317-4416 BC063300.1 3315-4414 4417-5388 BC052954.1 4432-5403

Séquence

Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable