SAB2101256

Anti-KIF12 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Kinesin family member 12, Anti-RP11-56P10.3
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 56 kDa
• Espèces réactives: dog, rabbit, human, bovine, guinea pig, rat
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès UniProt: B1ALC3
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... KIF12(113220)

Description

Immunogène

Synthetic peptide directed towards the N terminal region of human KIF12

Actions biochimiques/physiologiques

KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that play important roles in intracellular transport and cell division (Nakagawa et al., 1997 [PubMed 9275178]).[supplied by OMIM].

Séquence

Synthetic peptide located within the following region: SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable