Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

SAB2100604

Sigma-Aldrich

Anti-DNAJB1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DnaJ (Hsp40) homolog, subfamily B, member 1, Anti-HSPF1, Anti-Hdj1, Anti-Hsp40, Anti-Sis1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Numéro MDL:
MFCD02263107
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

38 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès UniProt

P25685

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DNAJB1(3337)

Description générale

DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) belongs to the heat shock protein 40 (HSP40) protein family. It contains a highly conserved J domain. The DNAJB1 gene is mapped to human chromosome 19p13.12.

Immunogène

Synthetic peptide directed towards the N terminal region of human DNAJB1

Application

Anti-DNAJB1 antibody produced in rabbit has been used in western blotting (1:500).

Actions biochimiques/physiologiques

DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) interacts with heat shock protein 70 (HSP70) and can stimulate its ATPase activity. It stimulates the association between heat shock cognate 70 kDa protein (HSC70) and Hsc70-interacting protein (HIP). In association with HSP70, HSP40 favors adenosine triphosphate (ATP)-dependent protein refolding, transport, and interaction. It acts as a negative regulator melanoma differentiation-associated gene 5 (MDA5) based mitochondrial antiviral signaling protein pathway and mitogen-inducible gene 6 (MIG6). It also blocks p53 mediated apoptosis by destabilizing programmed cell death 5 (PDCD5). Hsp40 mediates viral ribonucleoproteins (vRNPs) import and may serve as a potential antiviral target.

Séquence

Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Soo-Yeon Park et al.
Biochimica et biophysica acta, 1853(10 Pt A), 2722-2730 (2015-08-05)
Mitogen-inducible gene 6 (MIG6) is a tumor suppressor implicated in the development of human cancers; however, the regulatory mechanisms of MIG6 remain unknown. Here, using a yeast two-hybrid screen, we identified DnaJ homolog subfamily B member I (DNAJB1) as a
Xiao-Ting Feng et al.
BMC developmental biology, 19(1), 9-9 (2019-04-27)
Coilia nasus oogenesis/spawning migration is a well-defined synchronous arrangement process. DnaJs are indispensable molecular chaperones for oogenesis process. However, how DnaJs involved the anadromous spawning migration mechanism is outstanding and plausible. In this regard, two DnaJs (Cn-DnaJa1 and Cn-DnaJb1) are
Hongyue Ren et al.
Oncology reports, 42(6), 2622-2634 (2019-10-30)
Cholangiocarcinoma (CCA) represents a type of epithelial cancer with a late diagnosis and poor outcome. However, the molecular mechanisms responsible for the development of CCA have not yet been fully identified. Thus, in this study, we aimed to elucidate some
Ken Takashima et al.
Journal of innate immunity, 10(1), 44-55 (2017-10-27)
Melanoma differentiation-associated gene 5 (MDA5) is a pattern recognition receptor that recognizes cytoplasmic viral double-stranded RNA (dsRNA) and initiates rapid innate antiviral responses. MDA5 forms a filament-like multimer along the dsRNA leading to oligomerization, which in turn activates the adaptor

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique