SAB1412391

ANTI-HMGB2 antibody produced in mouse

clone 3D2, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : HMG2, HMGB2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3D2, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen 47.19 kDa
• Espèces réactives: human
• Technique(s): immunohistochemistry: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: BC000903
• Numéro d'accès UniProt: P26583
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... HMGB2(3148)

Description

Description générale

High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein encoded by the HMGB2 gene in humans. The protein belongs to a family of chromatin proteins made up of two basic DNA binding domains, HMG box A and B, and a C-terminal acidic tail. The gene is mapped to human chromosome 4q34.

Immunogène

HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE

Actions biochimiques/physiologiques

High-mobility group protein B2 (HMGB2) functions as a significant prognostic factor and may play a crucial role in cell invasion. The gene acts as a novel prognostic marker and an attractive therapeutic target for glioblastoma multiforme (GBM). The protein helps in altering DNA elasticity while facilitating transcription, replication and DNA repair. It plays a significant role in tumor development and during prognosis of hepatocellular carcinoma (HCC). It may also be associated with the anti-apoptotic pathway.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable