SAB1410940
Anti-IL23A antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Synonyme(s) :
IL-23, IL-23A, IL23P19, MGC79388, P19, SGRF
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
purified immunoglobulin
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
antigen 20.7 kDa
Espèces réactives
human
Technique(s)
western blot: 1 μg/mL
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
dry ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... IL23A(51561)
Description générale
Interleukin 23 subunit α (IL23A) gene with 4 exons, spanning 1531bp of genomic DNA, is mapped to human chromosome 12q13.2. The gene codes for a 19kDa cytokine, p19. The protein consists of a signal peptide and mature peptide composed of four α helices.
This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the β1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-γ(IFNG). In contrast to IL12, which acts mainly on naive CD4+ T cells, IL23 preferentially acts on memory CD4+ T cells. (provided by RefSeq)
Immunogène
IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length human protein.
Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Actions biochimiques/physiologiques
Interleukin 23 subunit α (IL23A) plays a vital role downstream of the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway, that transduces signals for cell proliferation, differentiation, cell migration and apoptosis. Elevated expression of IL23A has been observed in meibomian cell carcinoma (MCC). Mutation in the gene increases the risk of susceptibility to psoriatic arthritis (PsA) as well as psoriasis.
Forme physique
Solution in phosphate buffered saline, pH 7.4
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
IL23A (interleukin 23, alpha subunit p19)
Norimitsu Inoue
Atlas of Genetics and Cytogenetics in Oncology and Haematology, 1-4 (2010)
John Bowes et al.
Annals of the rheumatic diseases, 70(9), 1641-1644 (2011-05-31)
To investigate a shared genetic aetiology for skin involvement in psoriasis and psoriatic arthritis (PsA) by genotyping single-nucleotide polymorphisms (SNPs), reported to be associated in genome-wide association studies of psoriasis, in patients with PsA. SNPs with reported evidence for association
Arun Kumar et al.
Genomics, 90(5), 559-566 (2007-09-25)
Meibomian cell carcinoma (MCC) is a malignant tumor of the meibomian glands located in the eyelids. No information exists on the cytogenetic and genetic aspects of MCC. There is no report on the gene expression profile of MCC. Thus there
J Niu et al.
Clinical and experimental immunology, 176(3), 473-484 (2014-02-18)
Hepatic allograft rejection remains a challenging problem, with acute rejection episode as the major barrier for long-term survival in liver transplant recipients. To explore a strategy to prevent allograft rejection, we hypothesized that mesenchymal stem cells (MSCs) genetically engineered with
María Florencia Ogara et al.
Biochimica et biophysica acta, 1843(7), 1309-1324 (2014-04-08)
DNA damage, which perturbs genomic stability, has been linked to cognitive decline in the aging human brain, and mutations in DNA repair genes have neurological implications. Several studies have suggested that DNA damage is also increased in brain disorders such
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique