Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1408077

Sigma-Aldrich

Anti-SYT16 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

CHR14SYT, SYT14L, Strep14, syt14r, yt14r

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~22.8 kDa

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SYT16(83851)

Description générale

Mouse polyclonal antibody raised against a full-length human SYT16 protein.
SYT16 (synaptotagmin XVI) is a putative membrane trafficking protein belonging to the synaptotagmin (Syt) gene family. It is composed of a single N-terminal transmembrane domain and a putative fatty-acylation region adjacent to the transmembrane domain.

Immunogène

SYT16 (AAH40924.1, 1 a.a. ~ 203 a.a) full-length human protein.

Sequence
MTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLES

Application

Anti-SYT16 antibody produced in mouse is suitable for wstern blot analysis.

Actions biochimiques/physiologiques

The activity of SYT16 (synaptotagmin XVI) is dependent on the Ca(2+) similar to all the members of Syt family proteins. It forms Ca(2+) independent oligomer. It may be involved in membrane and vesicular trafficking in specific tissues outside the brain.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

M Craxton
Genomics, 77(1-2), 43-49 (2001-09-07)
I used TBLASTn to probe DNA sequence databases with a consensus peptide sequence corresponding to the most highly conserved region of the rodent synaptotagmin (Syt) gene family, which is within the C2B domain. I found human homologues for all known
Mitsunori Fukuda
Journal of biochemistry, 133(5), 641-649 (2003-06-13)
Synaptotagmins (Syts) represent a large family of putative membrane trafficking proteins found in various species from different phyla. In this study, I identified a novel class of Syt (named Syt XIV) conserved from Drosophila to humans and its highly related

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique