SAB1406373

Anti-RARRES2 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : CHEMERIN, HP10433, TIG2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~18.6 kDa
• Espèces réactives: human
• Technique(s): western blot: 1 μg/mL
• Numéro d'accès NCBI: NM_002889.2
• Numéro d'accès UniProt: Q99969
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... RARRES2(5919)

Description

Description générale

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. (provided by RefSeq)

Immunogène

RARRES2 (NP_002880.1, 1 a.a. ~ 163 a.a) full-length human protein.

Sequence
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS

Actions biochimiques/physiologiques

Chemerin activates chemerin-like receptor 1 (CMKLR1) and stimulates chemotaxis in macrophages, natural killer cells and immature dendritic cells. It is also involved in the activation of extracellular signal-regulated kinases, stimulation of blood vessel formation, migration and invasion.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable