SAB1404232

Monoclonal Anti-PPOX, (C-terminal) antibody produced in mouse

clone 2F12, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : MGC8485, PPO, V290M, VP
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2F12, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37.11 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: BC002357
• Numéro d'accès UniProt: P50336
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PPOX(5498)

Description

Description générale

This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified. (provided by RefSeq)

Immunogène

PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable