Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

SAB1403712

Sigma-Aldrich

Monoclonal Anti-CTLA4 antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

CD152, CELIAC3, CTLA-4, GSE, IDDM12

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2F1, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~37.11 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CTLA4(1493)

Catégories apparentées

Description générale

The CTLA4 (cytotoxic T lymphocyte associated-4) gene is mapped to human chromosome 2q33. It is a glycoprotein found on T-cells and is homologous to CD28 (Cluster of Differentiation 28) at the juxtamembrane and cytoplasmic regions.

Immunogène

CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY

Actions biochimiques/physiologiques

The CTLA4 (cytotoxic T lymphocyte associated-4) gene encodes a membrane receptor on cytotoxic T-cells that functions in T-cell apoptosis. It is a strong inhibitor of T-cell activation. It may be associated with type 1 diabetes. The gene has been identified as a susceptibility locus for Graves′ disease. It may be involved in the pathogenesis of autoimmune disorders.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

The CTLA-4 gene region of chromosome 2q33 is linked to, and associated with, type 1 diabetes.
Nistico L, et al.
Human Molecular Genetics, 5(7), 1075-1080 (1996)
CTLA-4 is a second receptor for the B cell activation antigen B7.
Linsley P S, et al.
The Journal of Experimental Medicine, 174(3), 561-569 (1991)
The development of Graves? disease and the CTLA-4 gene on chromosome 2q33.
Heward J M, et al.
The Journal of Clinical Endocrinology and Metabolism, 84(7), 2398-2401 (1999)
Daniele Saverino et al.
PloS one, 9(11), e112509-e112509 (2014-11-11)
Primary biliary cirrhosis (PBC) is a chronic autoimmune cholestatic liver disease frequently characterized by anti-mitochondrial autoantibodies (AMA). A minority of patients are AMA-negative. Cytotoxic-T-Lymphocyte-Antigen-4 (CTLA-4) is a surface molecule expressed on activated T-cells delivering a critical negative immunoregulatory signal. A
Sigrid Regauer et al.
Histology and histopathology, 29(8), 1017-1025 (2014-01-10)
Introduction. Lichen planus (LP) is a chronic cytokine-mediated disease of possible auto-immune etiology. 25% of men have anogenital manifestations. Erosive penile LP causes a scarring phimosis of the foreskin in uncircumcised men. Mast cells as potent immune modulators have been

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique