SAB1403533

Monoclonal Anti-NR0B1, (C-terminal) antibody produced in mouse

clone 2F12, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2F12, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~38.21 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_000475
• Numéro d'accès UniProt: P51843
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NR0B1(190)

Description

Description générale

Nuclear receptor subfamily 0 group B member 1 (NR0B1), also known as dosage-sensitive sex-reversal, adrenal hypoplasia congenital critical region on the X chromosome, protein 1 (DAX1), is an orphan nuclear receptor. The gene encoding this 470-amino acid protein consists of two exons. The protein possesses a carboxy-terminal domain (CTD) and an amino-terminal domain (NTD) which has three short repeats, each containing an LXXLL motif. NR0B1 is expressed in the anterior pituitary, hypothalamus, adrenal cortex and gonads. The gene is localized on human chromosome Xp21.

Immunogène

NR0B1 (NP_000466, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI

Actions biochimiques/physiologiques

Nuclear receptor subfamily 0 group B member 1 (NR0B1) has adrenal and reproductive functions. It acts as a repressor of gene transcription. The protein inhibits the functioning of steroidogenic factor 1 (SF-1), an orphan nuclear receptor. Mutations in the NR0B1 gene have been associated with X-linked adrenal hypoplasia congenita and hypogonadotropic hypogonadism.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable