SAB1402786

Monoclonal Anti-GGTLA1, (C-terminal) antibody produced in mouse

clone 3E10, ascites fluid

• Synonyme(s) : DKFZp566O011, FLJ92733, GGT-REL, GGTLA1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: ascites fluid
• Type de produit anticorps: primary antibodies
• Clone: 3E10, monoclonal
• Poids mol.: antigen ~34.58 kDa
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotype: IgMκ
• Numéro d'accès NCBI: NM_004121
• Numéro d'accès UniProt: P36269
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... GGT5(2687)

Description

Description générale

This gene is a member of a gene family that encodes gamma-glutamyl transpeptidase enzymes. This enzyme consists of a heavy and a light chain, and is able to hydrolyze the gamma-glutamyl moiety of glutathione. It converts leukotriene C4 to leukotriene D4, however, it doesn′t convert synthetic substrates that are commonly used to assay gamma-glutamyl transpeptidase. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogène

GGTLA1 (NP_004112.1, 510 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY

Forme physique

Clear solution

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable